"useCountToKudo" : "false", "selector" : "#kudosButtonV2_2", }, } else { "actions" : [ "event" : "MessagesWidgetAnswerForm", count++; var neededkeys = [76, 79, 71, 77, 69, 73, 78]; }, ], clearWarning(pagerId); ;(function($) { } "event" : "AcceptSolutionAction", } } "disableLinks" : "false", ] "event" : "removeThreadUserEmailSubscription", o.innerHTML = "Page number can\'t exceed 2. } }, return; }, } "event" : "editProductMessage", "action" : "rerender" "action" : "rerender" "context" : "", "event" : "MessagesWidgetMessageEdit", "useSubjectIcons" : "true", "displaySubject" : "true", ] "revokeMode" : "true", }, { { "event" : "QuickReply", "event" : "AcceptSolutionAction", } } ] "messageViewOptions" : "1111110111111111111110111110100101001101" { "event" : "MessagesWidgetCommentForm", "context" : "envParam:quiltName,product,contextId,contextUrl", }, { ] "event" : "addThreadUserEmailSubscription", ] "actions" : [ ] "context" : "lia-deleted-state", }, ich möchte nicht ausschließen, das es an einem Signalausfall liegt, wie Du vermutest. } }, "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ } { "action" : "rerender" } }, "context" : "", "event" : "approveMessage", "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.AjaxSupport.ComponentEvents.set({ "includeRepliesModerationState" : "false", } else { ] { "parameters" : { } LITHIUM.AjaxSupport.ComponentEvents.set({ ] "event" : "AcceptSolutionAction", ] "action" : "rerender" document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); "disableKudosForAnonUser" : "false", ] "actions" : [ "parameters" : { ] Die Verbindung der Fernbedienung mit der Horizon Box wird dadurch gespeichert. { { // If watching, pay attention to key presses, looking for right sequence. "actions" : [ { }, "useSubjectIcons" : "true", "context" : "envParam:entity", "context" : "envParam:quiltName,product,contextId,contextUrl", } { "action" : "rerender" { "eventActions" : [ }, }, "actions" : [ { "actions" : [ } { Versuchen Sie es nach der Verbindungsherstellung erneut. }, "truncateBodyRetainsHtml" : "false", LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); ] }, "displaySubject" : "true", "messageViewOptions" : "1111110111111111111110111110100101001101" } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); "truncateBody" : "true", "event" : "deleteMessage", "selector" : "#kudosButtonV2_2", } LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'Vslt2Oe75k6yaL4ztM50Uw-p_4c4rRFumE6R0kAcjhM. "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); { "context" : "", } "action" : "rerender" "action" : "rerender" "includeRepliesModerationState" : "false", } { LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'MXRzJc8gtpj6nI-pnc0B3RPCI9K09f7ME-YwoayRMew. "useTruncatedSubject" : "true", "action" : "rerender" "eventActions" : [ "actions" : [ { "action" : "rerender" "action" : "rerender" } "event" : "editProductMessage", } } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", "showCountOnly" : "false", "actions" : [ "actions" : [ "event" : "MessagesWidgetAnswerForm", { } LITHIUM.Loader.runJsAttached(); "context" : "", ] "selector" : "#kudosButtonV2_8", }, }, "context" : "envParam:quiltName", "forceSearchRequestParameterForBlurbBuilder" : "false", ] "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ { ;(function($) { ] } { ', 'ajax'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); ] "context" : "envParam:entity", { "context" : "", "showCountOnly" : "false", { }, } { "context" : "envParam:quiltName,message", ] }); "context" : "", "action" : "rerender" "action" : "rerender" "kudosable" : "true", { "action" : "pulsate" Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" } lithstudio: [], ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); function setWarning(pagerId) { { "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] "action" : "rerender" "event" : "editProductMessage", "actions" : [ { { "actions" : [ "showCountOnly" : "false", "showCountOnly" : "false", ] } }, ] } }, "action" : "rerender" "revokeMode" : "true", "event" : "unapproveMessage", "action" : "rerender" { { "context" : "envParam:selectedMessage", { "action" : "rerender" { ] "context" : "envParam:quiltName,message", "action" : "rerender" LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234194}); "action" : "rerender" "action" : "rerender" { o.innerHTML = ""; ] "}); "actions" : [ { "context" : "envParam:entity", ;(function($) { } LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { } "action" : "pulsate" }, ] "event" : "MessagesWidgetMessageEdit", "context" : "envParam:quiltName,message,product,contextId,contextUrl", { LITHIUM.AjaxSupport.ComponentEvents.set({ { LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); "parameters" : { "actions" : [ ] } "action" : "rerender" "componentId" : "forums.widget.message-view", "forceSearchRequestParameterForBlurbBuilder" : "false", disableInput(pagerId); }, { { ] LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "dialogKey" : "dialogKey" ] } ', 'ajax'); "context" : "envParam:quiltName,message,product,contextId,contextUrl", })(LITHIUM.jQuery); } { } "parameters" : { "context" : "", { { { { { "includeRepliesModerationState" : "false", "event" : "deleteMessage", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "unapproveMessage", "event" : "markAsSpamWithoutRedirect", "actions" : [ ] "}); ] } "action" : "rerender" ] }, "event" : "MessagesWidgetMessageEdit", "context" : "envParam:quiltName,expandedQuiltName", } "event" : "MessagesWidgetCommentForm", }, "disableKudosForAnonUser" : "false", } window.scrollTo(0,position_x.top - 150); } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/317490","ajaxErrorEventName":"LITHIUM:ajaxError","token":"7xM0BM92Aa6asHJjReq2uNzra1gWiG_bCgPiAbYG4R4. "event" : "ProductMessageEdit", ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); { }); ] "context" : "envParam:quiltName", "event" : "QuickReply", { "action" : "rerender" { } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2360276 .lia-rating-control-passive', '#form_6'); { }, { // enable redirect to login page when "logmein" is typed into the void =) } LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); "useCountToKudo" : "false", { "actions" : [ } // Oops. /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { function doChecks(pagerId, val) { "actions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2360275 .lia-rating-control-passive', '#form_5'); { { "event" : "addThreadUserEmailSubscription", LITHIUM.AjaxSupport.ComponentEvents.set({ { { "action" : "rerender" "event" : "ProductAnswer", "action" : "rerender" ] "context" : "envParam:quiltName,product,contextId,contextUrl", "useSimpleView" : "false", count = 0; LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/317490","ajaxErrorEventName":"LITHIUM:ajaxError","token":"f1-TCPnmP-ttioQBpJr_d_GcORXW8idFMr6_xyCVXCM. { window.location = "https://forum.vodafone.de/t5/St%C3%B6rungsmeldungen-Internet-TV/Fehler-meldung-1010-Horizon-TV-box/td-p/2360269" + "/page/" + val; "revokeMode" : "true", }, "initiatorBinding" : true, } "kudosLinksDisabled" : "false", "actions" : [ } "context" : "", "action" : "rerender" }, "action" : "rerender" { "actions" : [ element.siblings('li').find('ul').slideUp(); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); "actions" : [ } } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); "truncateBodyRetainsHtml" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:quiltName", "truncateBodyRetainsHtml" : "false", if (1 != val) "actions" : [ "action" : "addClassName" "action" : "addClassName" "context" : "envParam:entity", { "useSimpleView" : "false", ] "event" : "expandMessage", ] "event" : "ProductAnswer", "context" : "", "event" : "MessagesWidgetCommentForm", { "}); }, disableInput(pagerId); "event" : "deleteMessage", Versuchen Sie es nach der Verbindungsherstellung erneut. ] ] { "action" : "rerender" "action" : "rerender" "actions" : [ "activecastFullscreen" : false, "actions" : [ ] "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "", "displaySubject" : "true", ] { "context" : "", LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); "actions" : [ }, "context" : "envParam:quiltName", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_5","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2360269}},{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2360270}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2360271}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2360272}},{"elementId":"link_17","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2360273}},{"elementId":"link_20","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2360274}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2360275}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2360276}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2360277}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2360278}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2492762}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2492188}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2493193}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2493135}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2495862}},{"elementId":"link_40","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565828}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565724}},{"elementId":"link_42","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565665}},{"elementId":"link_44","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565632}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565564}},{"elementId":"link_46","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565485}},{"elementId":"link_47","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565414}},{"elementId":"link_48","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565384}},{"elementId":"link_49","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565375}},{"elementId":"link_50","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565369}}]); For more information on submitting your claims electronically, contact the e-Service Desk’s EDI team at 1-888-334-9242, via email … "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/317490","ajaxErrorEventName":"LITHIUM:ajaxError","token":"2ZyCZKUe05JKdr2EECW7-OHuNornq5f7bnj8egxQc9o. "context" : "", { ] }, } { "action" : "rerender" { LITHIUM.Loader.runJsAttached(); "event" : "QuickReply", "context" : "", }; "useCountToKudo" : "false", Hope this helps! { } "context" : "", "context" : "envParam:quiltName,message,product,contextId,contextUrl", { "showCountOnly" : "false", } ] { { "action" : "rerender" return; "entity" : "2360270", }, ] "actions" : [ } "action" : "rerender" "selector" : "#kudosButtonV2_6", "action" : "rerender" { "event" : "MessagesWidgetMessageEdit", "actions" : [ "action" : "rerender" "eventActions" : [ "action" : "rerender" "event" : "markAsSpamWithoutRedirect", { }, "actions" : [ ] "actions" : [ ] ] ] .attr('aria-selected','false'); "kudosable" : "true", ] } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { { { }); }, ] { } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, "actions" : [ "truncateBody" : "true", "action" : "rerender" { LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'xU_oL4GPwILwvPr8mfkiC8J1zR6lexjdg9iJ0RE6mwY. ] createStorage("true"); { { { { }, { }, } "event" : "MessagesWidgetAnswerForm", } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "actions" : [ } { "disableKudosForAnonUser" : "false", { "action" : "rerender" LITHIUM.Dialog.options['1958112238'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { $(document).ready(function(){ { "action" : "rerender" { } "action" : "rerender" "event" : "MessagesWidgetAnswerForm", "context" : "", }, { { "event" : "MessagesWidgetMessageEdit", } }, { "action" : "rerender" } "context" : "envParam:entity", "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'uRGFDFhqk8faIR6EEv7PVTcOjWczTamm5jysAcpfcUs. "eventActions" : [ "action" : "rerender" { "event" : "addThreadUserEmailSubscription", "showCountOnly" : "false", "event" : "MessagesWidgetEditAction", { }); }); ] } ], "context" : "lia-deleted-state", "event" : "expandMessage", "action" : "rerender" "event" : "editProductMessage", ] "context" : "", "actions" : [ "truncateBody" : "true", "disableKudosForAnonUser" : "false", { return false; { "useCountToKudo" : "false", "parameters" : { }, LITHIUM.AjaxSupport.ComponentEvents.set({ { }, ] "context" : "envParam:quiltName", { "; { "revokeMode" : "true", { "initiatorBinding" : true, { "event" : "deleteMessage", "action" : "addClassName" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] "action" : "rerender" var clickedDomElement = $(this); LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); }, "eventActions" : [ "accessibility" : false, { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2360278,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "envParam:selectedMessage", "actions" : [ "actions" : [ "context" : "", Easy to use and affordable, the T101 treadmill has everything you need for a comfortable workout. { "event" : "expandMessage", { "action" : "rerender" { ] "event" : "MessagesWidgetEditAnswerForm", "linkDisabled" : "false" } Es muss ja nicht die Dose defekt sein, sondern das Signal kann ja schon gestört an der Dose ankommen. "action" : "rerender" "event" : "ProductMessageEdit", } } "parameters" : { "dialogContentCssClass" : "lia-panel-dialog-content", { }, "displayStyle" : "horizontal", // Oops, not the right sequence, lets restart from the top. })(LITHIUM.jQuery); // Pull in global jQuery reference }, "context" : "", ]

Trebnitzer Straße Nürnberg, ärzte Katharinenhospital Stuttgart, Agatha Raisin - Staffel 3 Sendetermine, Poseidon Film 1972, Lka Hamburg überseering 35, Ziemlich Beste Freunde Anderer Film, Kastanienallee 52-54 Essen, Zeitmesser Kreuzworträtsel 3 Buchstaben, Trampelnde Nachbarn Rache, Kastanienallee 52-54 Essen, Stadt In Oberitalien 5 Buchstaben, Internistische Gemeinschaftspraxis Erlangen, Neurologe Stuttgart Möhringen,